PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G192900.1
Common NamePHAVU_006G192900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 364aa    MW: 41141.9 Da    PI: 6.1807
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G192900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.11.1e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WTteEd++lvd+++++G g+W+t ++  g+ R++k+c++rw +yl
  Phvul.006G192900.1 14 KGPWTTEEDQKLVDYIQKHGCGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding54.42.8e-1767111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Phvul.006G192900.1  67 RGRFSFEEEETIIQLHSILGNK-WSAIASRLP-GRTDNEIKNYWNTH 111
                         89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.214961IPR017930Myb domain
SuperFamilySSF466891.01E-3111108IPR009057Homeodomain-like
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002495.0E-171461IPR001005SANT/Myb domain
CDDcd001672.60E-121661No hitNo description
PROSITE profilePS5129425.08762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
CDDcd001671.89E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGRAPCCEKN GLKKGPWTTE EDQKLVDYIQ KHGCGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIASRLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDISSILN ASFYGSSQML LGMQQSMVNP ELLRLASSLF SSSHQHKDLD  180
VCVPKGQQNQ VCDPQVQNHV PHLVQFQDPV QEVPACVSLP LSQPQLVEPH NVDPYPSSTF  240
SDFTYQQHSH DDQIISDWHK DGVALSTLTD DYVPQLSSYN YYSSDDLMYP PFSQPSTFHS  300
NNSNQNFSFA SVLSTPSSSP TPLNSNSTII NGSNTEDERD QSYGSSSMLK FEIPDILDVN  360
EFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312020.0KT031202.1 Glycine max clone HN_CCL_70 MYB/HD-like transcription factor (Glyma13g32090.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148253.10.0hypothetical protein PHAVU_006G192900g
TrEMBLV7BQH60.0V7BQH6_PHAVU; Uncharacterized protein
STRINGGLYMA13G32090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-102MYB-like 102